PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.A01648.1.p
Common NameEUGRSUZ_A01648
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 211aa    MW: 24601.9 Da    PI: 7.0633
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.A01648.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.13.1e-161562148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+W ++Ede+l   v+ lG ++W+ Ia+t g++R++k+c++rw +yl
  Eucgr.A01648.1.p 15 KGPWIEQEDEILTAFVTVLGERRWDYIAKTSGLKRSGKSCRLRWKNYL 62
                      79********************************************97 PP

2Myb_DNA-binding51.52.3e-1669113248
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       g+ ++eE+ ++++ ++q+G++ W++Ia++++ gRt++++k++w ++l
  Eucgr.A01648.1.p  69 GPISPEEERIIIKFHEQWGNK-WSRIAEKLP-GRTDNEIKNFWKTHL 113
                       6789*****************.*********.***********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.1061062IPR017930Myb domain
SuperFamilySSF466894.21E-2713109IPR009057Homeodomain-like
SMARTSM007171.2E-71464IPR001005SANT/Myb domain
PfamPF002491.6E-111562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-201669IPR009057Homeodomain-like
CDDcd001671.58E-61762No hitNo description
PROSITE profilePS5129425.05963117IPR017930Myb domain
SMARTSM007174.2E-1667115IPR001005SANT/Myb domain
PfamPF002497.6E-1569113IPR001005SANT/Myb domain
CDDcd001675.11E-1170113No hitNo description
Gene3DG3DSA:1.10.10.602.6E-2470117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MMGHRGEARE EKLRKGPWIE QEDEILTAFV TVLGERRWDY IAKTSGLKRS GKSCRLRWKN  60
YLCPNLKHGP ISPEEERIII KFHEQWGNKW SRIAEKLPGR TDNEIKNFWK THLRKKVQSS  120
KQALIGAACD DPESQMTTGS SLNVLSFSDF SHLNSPYEIR LLDWMSEFGN DANEVNCVDC  180
KHWGLCFCFP KWDFEEVDNS IWNCPGYLWE *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-25131172105MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-25131172105C-Myb DNA-Binding Domain
1msf_C2e-25131172105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00406DAPTransfer from AT3G53200Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.A01648.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010050632.11e-149PREDICTED: transcription factor MYB59
SwissprotQ4JL847e-52MYB59_ARATH; Transcription factor MYB59
TrEMBLA0A059DFK91e-157A0A059DFK9_EUCGR; Uncharacterized protein
STRINGPOPTR_0006s12400.17e-63(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM113972533
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53200.13e-57myb domain protein 27